PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G038500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 712aa    MW: 78026.5 Da    PI: 6.5074
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G038500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.9e-192782156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++ +++t++q++ Le++F++ ++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Potri.012G038500.1 27 KKRYHRHTAHQIQKLESMFKEFPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 82
                        678899***********************************************998 PP

2START185.13.8e-582254462206
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         +a  a++el+++ +a+e +W+kss    + +n d + ++f+++ +       ++e +r+sgvv+m+ + lv  ++d++ +W e ++     
  Potri.012G038500.1 225 VATNAMEELLRLLQANESLWMKSStdgrDVLNLDSYQRIFPRAMShlknpnVRIESSRDSGVVIMNGVALVDMFMDSN-KWVESFPtivsV 314
                         57789*********************99999999999999998779999999**************************.**********9* PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a+t+evissg      g lqlm+ elq+lsplvp R+f ++Ry++q ++g w+iv+vS d +q+ ++      +++lpSg+li++++ng+s
  Potri.012G038500.1 315 AKTIEVISSGmlgnhsGSLQLMYEELQVLSPLVPtREFCILRYCQQIEQGLWAIVSVSYDIPQFASQ----FQCHRLPSGCLIQDMPNGYS 401
                         ****************************************************************986....999***************** PP

                         EEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         kv+wvehv+ +++ p h+l+r l++sgla+ga +w+atlqr ce+
  Potri.012G038500.1 402 KVIWVEHVEIEDKAPtHQLYRDLIHSGLAFGAERWLATLQRMCER 446
                         *******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-201084IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-221278IPR009057Homeodomain-like
PROSITE profilePS5007117.9292484IPR001356Homeobox domain
SMARTSM003894.9E-182588IPR001356Homeobox domain
CDDcd000867.97E-182685No hitNo description
PfamPF000462.0E-162782IPR001356Homeobox domain
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PROSITE profilePS5084851.68215449IPR002913START domain
SuperFamilySSF559612.09E-37216447No hitNo description
CDDcd088751.41E-118219445No hitNo description
SMARTSM002344.1E-52224446IPR002913START domain
PfamPF018521.4E-50225446IPR002913START domain
Gene3DG3DSA:3.30.530.202.4E-7293444IPR023393START-like domain
SuperFamilySSF559616.87E-22467703No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MEYGSAGGGS GGGGGGDHDS SDPQRRKKRY HRHTAHQIQK LESMFKEFPH PDEKQRLQLS  60
RELGLAPRQI KFWFQNRRTQ MKAQHERADN SSLRAENDKI RCENIAIREA LKNVICPSCG  120
APPVTEDSYF DEQKLRIENA QLKEELDRVS SIAAKYIGRP ISQLPPVQPV HISSLDLSMG  180
NFGGQGLGGP ALDLDLDLDL IPTNSNLAFQ PPGISDMDKS LMTDVATNAM EELLRLLQAN  240
ESLWMKSSTD GRDVLNLDSY QRIFPRAMSH LKNPNVRIES SRDSGVVIMN GVALVDMFMD  300
SNKWVESFPT IVSVAKTIEV ISSGMLGNHS GSLQLMYEEL QVLSPLVPTR EFCILRYCQQ  360
IEQGLWAIVS VSYDIPQFAS QFQCHRLPSG CLIQDMPNGY SKVIWVEHVE IEDKAPTHQL  420
YRDLIHSGLA FGAERWLATL QRMCERVACQ MVSGSSTRDL GGVIPSPEGK RSMMKLGQRM  480
VSSFCSSIST SNSHRWSTLS GLHDVGVRIT LHKNTDPGQP NGVVLSAATT FSLPVSPQNV  540
FNFFKDEKTR PQWDVLSSGN AVQEVAHIAN GSHPGNCISV LRAYNTSQNN MLILQESCMD  600
SSGSLVVYCP VDLPAINIAM SGEDPSYIPL LPSGFTISPD GYPDQGDGAS TSSNTQGRMA  660
RSSGSLITVA FQILVSSLPS ARLNLESVNT VNSLIGTTIQ QIKAALSCPG S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.72560.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317722.20.0hypothetical protein POPTR_0012s03550g
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLB9I4X30.0B9I4X3_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11